PDB entry 1v5k

View 1v5k on RCSB PDB site
Description: Solution structure of the CH domain from mouse EB-1
Class: structural protein, protein binding
Keywords: calponin homology (CH) domain, microtubule binding, adenomatosis polyposis coli binding protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: microtubule-associated protein, RP/EB family, member 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2900038A16
    Database cross-references and differences (RAF-indexed):
    • GB NP_031922 (7-108)
      • cloning artifact (0-6)
      • engineered (7-8)
      • cloning artifact (109-114)
    Domains in SCOPe 2.08: d1v5ka1, d1v5ka2, d1v5ka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5kA (A:)
    gssgssgqrrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakl
    eheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdsgpssg