PDB entry 1v5i

View 1v5i on RCSB PDB site
Description: Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
Class: hydrolase/PROTEIN BINDING
Keywords: protease-inhibitor complex, POIA1, subtilisin, hydrolase-PROTEIN BINDING COMPLEX
Deposited on 2003-11-24, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin bpn'
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • engineered mutation (220)
    Domains in SCOPe 2.07: d1v5ia_
  • Chain 'B':
    Compound: IA-1=serine proteinase inhibitor
    Species: Pleurotus ostreatus [TaxId:5322]
    Gene: POIA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M4T6 (0-75)
      • engineered mutation (70-75)
    Domains in SCOPe 2.07: d1v5ib1
  • Heterogens: SO4, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5iA (A:)
    aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasmvpsetnpfqd
    nnshgthvagtvaalnnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgav
    dssnqrasfssvgpeldvmapgvsiqstlpgnkygayngtcmasphvagaaalilskhpn
    wtntqvrsslentttklgdsfyygkglinvqaaaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5iB (B:)
    sagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqglq
    gdlidsieedhvahay