PDB entry 1v5h

View 1v5h on RCSB PDB site
Description: Crystal Structure of Human Cytoglobin (Ferric Form)
Class: oxygen storage/transport
Keywords: globin, heme, oxygen transport, oxygen storage, ligand binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-11-23, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: CYGB, STAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5ha_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v5hA (A:)
    gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsak
    qyfsqfkhmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkh
    kvepvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpn
    attppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5hA (A:)
    eaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhmedplemerspqlrk
    hacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvaeefa
    sdfppetqrawaklrgliyshvtaaykevgw