PDB entry 1v5g

View 1v5g on RCSB PDB site
Description: Crystal Structure of the Reaction Intermediate between Pyruvate oxidase containing FAD and TPP, and Substrate Pyruvate
Class: oxidoreductase
Keywords: Oxidoreductase, Flavoprotein
Deposited on 2003-11-22, released 2005-06-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V5G (0-588)
    Domains in SCOPe 2.04: d1v5ga1, d1v5ga2, d1v5ga3
  • Heterogens: MG, FAD, HTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5gA (A:)
    nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm
    qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp
    mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssans
    lrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknf
    etfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidid
    pamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee
    gdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaipg
    glgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedtn
    knlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqdr
    pipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik