PDB entry 1v5f

View 1v5f on RCSB PDB site
Description: Crystal Structure of Pyruvate oxidase complexed with FAD and TPP, from Aerococcus viridans
Class: oxidoreductase
Keywords: Oxidoreductase, Flavoprotein
Deposited on 2003-11-22, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Aerococcus viridans
    Domains in SCOP 1.73: d1v5fa1, d1v5fa2, d1v5fa3
  • Heterogens: MG, SO4, FAD, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5fA (A:)
    nkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaavm
    qskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqnp
    mydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssans
    lrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknf
    etfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidid
    pamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee
    gdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaipg
    glgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedtn
    knlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqdr
    pipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik