PDB entry 1v5e

View 1v5e on RCSB PDB site
Description: Crystal Structure of Pyruvate oxidase containing FAD, from Aerococcus viridans
Class: oxidoreductase
Keywords: Oxidoreductase, Flavoprotein
Deposited on 2003-11-22, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.231
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V5E (0-589)
    Domains in SCOPe 2.07: d1v5ea1, d1v5ea2, d1v5ea3
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5eA (A:)
    dnkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaav
    mqskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqn
    pmydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssan
    slrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgkn
    fetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidi
    dpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletke
    egdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaip
    gglgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedt
    nknlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqd
    rpipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik