PDB entry 1v5d

View 1v5d on RCSB PDB site
Description: The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4
Class: hydrolase
Keywords: chitosan degradation, hydrolase, glycosil hydrolase, family 8
Deposited on 2003-11-22, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V5D (0-385)
    Domains in SCOPe 2.06: d1v5da_
  • Chain 'B':
    Compound: Chitosanase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V5D (0-385)
    Domains in SCOPe 2.06: d1v5db_
  • Heterogens: PIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5dA (A:)
    akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
    tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
    adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
    qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
    lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
    wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
    reryfsdsynlltmlfitgnwwkpvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5dB (B:)
    akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
    tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
    adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
    qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
    lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
    wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
    reryfsdsynlltmlfitgnwwkpvp