PDB entry 1v59

View 1v59 on RCSB PDB site
Description: Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+
Class: oxidoreductase
Keywords: 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex, lipoamide dehydrogenase, dihydrolipoamide dehydrogenase, pyridine nucleotide-disulphide oxidoreductase, NAD+
Deposited on 2003-11-21, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v59a1, d1v59a2, d1v59a3
  • Chain 'B':
    Compound: dihydrolipoamide dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v59b1, d1v59b2, d1v59b3
  • Heterogens: PO4, FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v59A (A:)
    tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
    lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
    edetkirvtpvdglegtvkedhildvkniivatgsevtpfpgieideekivsstgalslk
    eipkrltiigggiiglemgsvysrlgskvtvvefqpqigasmdgevakatqkflkkqgld
    fklstkvisakrnddknvveivvedtktnkqenleaevllvavgrrpyiaglgaekigle
    vdkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvnynnip
    svmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilidskteri
    lgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydkaihc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v59B (B:)
    tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
    lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
    edetkirvtpvdglegtvkedhildvkniivatgsevtpfpgieideekivsstgalslk
    eipkrltiigggiiglemgsvysrlgskvtvvefqpqigasmdgevakatqkflkkqgld
    fklstkvisakrnddknvveivvedtktnkqenleaevllvavgrrpyiaglgaekigle
    vdkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvnynnip
    svmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilidskteri
    lgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydkaihc