PDB entry 1v57

View 1v57 on RCSB PDB site
Description: Crystal Structure of the Disulfide Bond Isomerase DsbG
Class: isomerase
Keywords: oxidized dsbg, redox protein, protein disulfide isomerase, thioredoxin fold, strained redox-active center
Deposited on 2003-11-21, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbG
    Species: Escherichia coli [TaxId:562]
    Gene: dsbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v57a1, d1v57a2
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbG
    Species: Escherichia coli [TaxId:562]
    Gene: dsbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v57b1, d1v57b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v57A (A:)
    eelpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekg
    enlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqar
    pwvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvste
    qmkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgnklqhhhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v57A (A:)
    elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
    nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
    wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
    mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v57B (B:)
    eelpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekg
    enlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqar
    pwvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvste
    qmkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgnklqhhhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v57B (B:)
    elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
    nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
    wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
    mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn