PDB entry 1v56

View 1v56 on RCSB PDB site
Description: three-dimensional solution structure of spinoxin, a potassium channel blocker
Deposited on 2003-11-21, released 2005-03-01
Made obsolete on 2016-04-20

The last revision was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spinoxin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1V56 (0-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v56A (A:)
    ircsgsrdcyspcmkqtgcpnakcinksckcygc