PDB entry 1v53

View 1v53 on RCSB PDB site
Description: The crystal structure of 3-isopropylmalate dehydrogenase from Bacillus coagulans
Class: oxidoreductase
Keywords: 3-isopropylmalate dehydrogenase, IPMDH, Bacillus coagulans, homo dimer, X-ray analysis, crystal structure, OXIDOREDUCTASE
Deposited on 2003-11-20, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v53a_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v53b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v53A (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    gprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v53A (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v53B (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    gprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v53B (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln