PDB entry 1v52

View 1v52 on RCSB PDB site
Description: Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Deposited on 2003-11-20, released 2005-06-28
The last revision was dated 2006-04-25, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein disulfide isomerase
    Species: Humicola insolens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55059 (6-132)
      • cloning artifact (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v52A (A:)
    gplgspligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgti
    dakafgahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiep
    siksepipekqeg