PDB entry 1v51

View 1v51 on RCSB PDB site
Description: The functional role of the binuclear metal center in D-aminoacylase. One-metal activation and second-metal attenuation
Class: Hydrolase
Keywords: TIM barrel, beta barrel, insertion, Hydrolase
Deposited on 2003-11-20, released 2004-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-aminoacylase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: DA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v51a1, d1v51a2, d1v51a3
  • Heterogens: ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v51A (A:)
    mrgshhhhhhgsmsqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsass
    arrridvagkvvspgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahan
    ppapldlldeggsfrfarfsdylealraappavnaacmvghstlraavmpdlrreatade
    iqamqaladdalasgaigistgafyppaahasteeiievcrplithggvyathmrdegeh
    ivqaleetfrigreldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyva
    gstmlkqdrvllagrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmm
    depdvqrilafgptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtg
    ltaakfglaergqvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedq
    sftgqhagrvlnraga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v51A (A:)
    pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvspgfids
    hthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsfrfarf
    sdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalasgaigi
    stgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigreldvpv
    vishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllagrtlit
    wckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgptmigsd
    glphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaergqvqpgyy
    adlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvlnr