PDB entry 1v4y

View 1v4y on RCSB PDB site
Description: The functional role of the binuclear metal center in D-aminoacylase. One-metal activation and second-metal attenuation
Deposited on 2003-11-20, released 2004-04-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.188
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4yA (A:)
    mrgshhhhhhgsmsqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsass
    arrridvagkvvspgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahan
    ppapldlldeggsfrfarfsdylealraappavnaacmvghstlraavmpdlrreatade
    iqamqaladdalasgaigistgafyppaahasteeiievcrplithggvyatamrdegeh
    ivqaleetfrigreldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyva
    gstmlkqdrvllagrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmm
    depdvqrilafgptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtg
    ltaakfglaergqvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedq
    sftgqhagrvlnraga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4yA (A:)
    pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvspgfids
    hthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsfrfarf
    sdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalasgaigi
    stgafyppaahasteeiievcrplithggvyatamrdegehivqaleetfrigreldvpv
    vishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllagrtlit
    wckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgptmigsd
    glphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaergqvqpgyy
    adlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvlnr