PDB entry 1v4x

View 1v4x on RCSB PDB site
Description: Crystal structure of bluefin tuna hemoglobin deoxy form at pH5.0
Class: oxygen storage/transport
Keywords: oxygen transport, heme, respiratory protein, erythrocyte, root effect, swim bladder, oxygen storage/transport complex
Deposited on 2003-11-19, released 2004-07-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v4xa_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v4xb_
  • Chain 'C':
    Compound: hemoglobin alpha chain
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v4xc_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v4xd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4xA (A:)
    ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
    gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
    pdahvsldkflasvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4xB (B:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalgrkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4xC (C:)
    ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
    gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
    pdahvsldkflasvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4xD (D:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalgrkyh