PDB entry 1v4v

View 1v4v on RCSB PDB site
Description: Crystal Structure Of UDP-N-Acetylglucosamine 2-Epimerase From Thermus Thermophilus HB8
Class: isomerase
Keywords: UDP-GlcNAc, Two Domains, Homodimer, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-11-19, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Thermus thermophilus [TaxId:274]
    Gene: cap5P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v4va_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Thermus thermophilus [TaxId:274]
    Gene: cap5P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v4vb_
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4vA (A:)
    meggmkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqed
    rnldvmqerqalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvgh
    veaglrsgnlkepfpeeanrrltdvltdldfaptplakanllkegkreegilvtgqtgvd
    avllaaklgrlpeglpegpyvtvtmhrrenwpllsdlaqalkrvaeafphltfvypvhln
    pvvreavfpvlkgvrnfvlldpleygsmaalmraslllvtdsgglqeegaalgvpvvvlr
    nvterpeglkagilklagtdpegvyrvvkgllenpeelsrmrkaknpygdgkaglmvarg
    vawrlglgprpedwlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4vA (A:)
    gmkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqedrnl
    dvmqerqalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvghvea
    glrsgnlkepfpeeanrrltdvltdldfaptplakanllkegkreegilvtgqtgvdavl
    laaklgrlpeglpegpyvtvtmhrrenwpllsdlaqalkrvaeafphltfvypvhlnpvv
    reavfpvlkgvrnfvlldpleygsmaalmraslllvtdsgglqeegaalgvpvvvlrnvt
    erpeglkagilklagtdpegvyrvvkgllenpeelsrmrkaknpygdgkaglmvargvaw
    rlglgprpedwlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4vB (B:)
    meggmkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqed
    rnldvmqerqalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvgh
    veaglrsgnlkepfpeeanrrltdvltdldfaptplakanllkegkreegilvtgqtgvd
    avllaaklgrlpeglpegpyvtvtmhrrenwpllsdlaqalkrvaeafphltfvypvhln
    pvvreavfpvlkgvrnfvlldpleygsmaalmraslllvtdsgglqeegaalgvpvvvlr
    nvterpeglkagilklagtdpegvyrvvkgllenpeelsrmrkaknpygdgkaglmvarg
    vawrlglgprpedwlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4vB (B:)
    mkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqedrnld
    vmqerqalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvghveag
    lrsgnlkepfpeeanrrltdvltdldfaptplakanllkegkreegilvtgqtgvdavll
    aaklgrlpeglpegpyvtvtmhrrenwpllsdlaqalkrvaeafphltfvypvhlnpvvr
    eavfpvlkgvrnfvlldpleygsmaalmraslllvtdsgglqeegaalgvpvvvlrnvte
    rpeglkagilklagtdpegvyrvvkgllenpeelsrmrkaknpygdgkaglmvargvawr
    lglgprpedwlp