PDB entry 1v4u

View 1v4u on RCSB PDB site
Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin
Deposited on 2003-11-19, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v4ua_
  • Chain 'B':
    Domains in SCOP 1.69: d1v4ub_
  • Chain 'C':
    Domains in SCOP 1.69: d1v4uc_
  • Chain 'D':
    Domains in SCOP 1.69: d1v4ud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4uA (A:)
    ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
    gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
    pdahvsldkflasvalalaeryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4uB (B:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalgrkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4uB (B:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4uC (C:)
    ttlsdkdkstvkalwgkisksadaigadalgrmlavypqtktyfshwpdmspgsgpvkah
    gkkvmggvalavskiddlttglgdlselhafkmrvdpsnfkilshcilvvvakmfpkeft
    pdahvsldkflasvalalaeryr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v4uD (D:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalgrkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4uD (D:)
    vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
    aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
    aftvetqcafqkflavvvfalg