PDB entry 1v4t

View 1v4t on RCSB PDB site
Description: Crystal structure of human glucokinase
Class: transferase
Keywords: hexokinase IV, allosteric enzyme, diabetes, TRANSFERASE
Deposited on 2003-11-19, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.244
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucokinase isoform 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35557 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.07: d1v4ta1, d1v4ta2
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4tA (A:)
    mveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdf
    lsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfl
    dkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgd
    femdvvamvndtvatmiscyyedhqcevgmivgtgcnacymeemqnvelvegdegrmcvn
    tewgafgdsgeldeflleydrlvdessanpgqqlyekliggkymgelvrlvllrlvdenl
    lfhgeaseqlrtrgafetrfvsqvesdtgdrkqiynilstlglrpsttdcdivrracesv
    straahmcsaglagvinrmresrsedvmritvgvdgsvyklhpsfkerfhasvrrltpsc
    eitfieseegsgrgaalvsavackkacmlgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4tA (A:)
    mveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdf
    lsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfl
    dkhqmkhkklplgftfsfpvrhnvvgllrdaikrrgdfemdvvamvndtvatmiscyyed
    hqcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlv
    dessanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsq
    vesdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresr
    sedvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavac
    kkac