PDB entry 1v4p

View 1v4p on RCSB PDB site
Description: Crystal structure of Alanyl-tRNA Synthetase from Pyrococcus horikoshii OT3
Class: ligase
Keywords: alanyl-tRNA synthetase, alanine-tRNA ligase, Pyrococcus horikoshii, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-11-14, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.206
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v4pa_
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v4pb_
  • Chain 'C':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v4pc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4pA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4pA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfell
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4pB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4pB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfell
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v4pC (C:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4pC (C:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelen