PDB entry 1v4n

View 1v4n on RCSB PDB site
Description: Structure of 5'-deoxy-5'-methylthioadenosine phosphorylase homologue from Sulfolobus tokodaii
Deposited on 2003-11-14, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v4na_
  • Chain 'B':
    Domains in SCOP 1.71: d1v4nb_
  • Chain 'C':
    Domains in SCOP 1.71: d1v4nc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4nA (A:)
    mmiepkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprh
    grghripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrt
    ytffdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivw
    kevfkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakv
    kkllyevirrlpekpderkcsccqalktalvlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4nA (A:)
    ekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrghri
    pphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytffdg
    ptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkevfka
    diigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkllye
    virrlpekpderkcsccqalktalvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4nB (B:)
    mmiepkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprh
    grghripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrt
    ytffdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivw
    kevfkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakv
    kkllyevirrlpekpderkcsccqalktalvlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4nB (B:)
    epkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrg
    hripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytf
    fdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkev
    fkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkl
    lyevirrlpekpderkcsccqalktalvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v4nC (C:)
    mmiepkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprh
    grghripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrt
    ytffdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivw
    kevfkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakv
    kkllyevirrlpekpderkcsccqalktalvlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4nC (C:)
    pkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrgh
    ripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytff
    dgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkevf
    kadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkll
    yevirrlpekpderkcsccqalktalv