PDB entry 1v4l

View 1v4l on RCSB PDB site
Description:
Deposited on 2003-11-14, released 2003-12-02
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4la_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4lb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4lc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4ld_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4le_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1v4lf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lA (A:)
    dfdcipgwsaydrycyqafsepknwedaesfceegvktshlvsiessgegdfvaqlvaek
    iktsfqyvwiglriqnkeqqcrsewsdassvnyenlykqsskkcyalkkgtelrtwfnvy
    cgrenpfvckytpec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lB (B:)
    gfccplgwssydehcyqvfqqkmnwedaekfctqqhrgshlvsfhsseevdfvvsktspi
    lkhdfvwmglsnvwnecakewsdgtkldykawsgqsdcitskttdnqwlsmdcsskryvv
    ckfqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lC (C:)
    dfdcipgwsaydrycyqafsepknwedaesfceegvktshlvsiessgegdfvaqlvaek
    iktsfqyvwiglriqnkeqqcrsewsdassvnyenlykqsskkcyalkkgtelrtwfnvy
    cgrenpfvckytpec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lD (D:)
    gfccplgwssydehcyqvfqqkmnwedaekfctqqhrgshlvsfhsseevdfvvsktspi
    lkhdfvwmglsnvwnecakewsdgtkldykawsgqsdcitskttdnqwlsmdcsskryvv
    ckfqa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lE (E:)
    dfdcipgwsaydrycyqafsepknwedaesfceegvktshlvsiessgegdfvaqlvaek
    iktsfqyvwiglriqnkeqqcrsewsdassvnyenlykqsskkcyalkkgtelrtwfnvy
    cgrenpfvckytpec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v4lF (F:)
    gfccplgwssydehcyqvfqqkmnwedaekfctqqhrgshlvsfhsseevdfvvsktspi
    lkhdfvwmglsnvwnecakewsdgtkldykawsgqsdcitskttdnqwlsmdcsskryvv
    ckfqa