PDB entry 1v4g

View 1v4g on RCSB PDB site
Description: crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b
Deposited on 2003-11-13, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v4ga_
  • Chain 'B':
    Domains in SCOP 1.71: d1v4gb_
  • Chain 'C':
    Domains in SCOP 1.71: d1v4gc_
  • Chain 'D':
    Domains in SCOP 1.71: d1v4gd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4gA (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gA (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgytnksqsnl
    gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
    rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
    lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
    qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
    aereaserrqqemeaadtepfavwlekha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4gB (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gB (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgyqsnlgitf
    ndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsge
    spsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselact
    rvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvc
    delvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaere
    aserrqqemeaadtepfavwlekha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v4gC (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gC (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakdisgadakekisagyfr
    virnyyrfgwvipylfgaspaisssflslpfektgmyylpyatslrlsdlgytnksqsnl
    gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
    rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
    lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
    qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
    aereaserrqqemeaadtepfavwlekha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v4gD (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gD (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakkekisagyfrvirnyyr
    fgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgysqsnlgitfndly
    eyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsd
    allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
    nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
    acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
    rqqemeaadtepfavwlekha