PDB entry 1v4g

View 1v4g on RCSB PDB site
Description: Crystal Structure of gamma-Glutamylcysteine Synthetase from Escherichia coli B
Class: ligase
Keywords: glutathione regulation, beta barrel, peptide synthesis, LIGASE
Deposited on 2003-11-13, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • modified residue (0)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.07: d1v4ga_
  • Chain 'B':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • modified residue (0)
      • engineered (105)
      • engineered (163)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.07: d1v4gb_
  • Chain 'C':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • modified residue (0)
      • engineered (105)
      • engineered (204)
    Domains in SCOPe 2.07: d1v4gc_
  • Chain 'D':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: GSH-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • modified residue (0)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.07: d1v4gd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4gA (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gA (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgytnksqsnl
    gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
    rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
    lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
    qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
    aereaserrqqemeaadtepfavwlekha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4gB (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gB (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgyqsnlgitf
    ndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsge
    spsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselact
    rvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvc
    delvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaere
    aserrqqemeaadtepfavwlekha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v4gC (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gC (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakdisgadakekisagyfr
    virnyyrfgwvipylfgaspaisssflslpfektgmyylpyatslrlsdlgytnksqsnl
    gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
    rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
    lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
    qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
    aereaserrqqemeaadtepfavwlekha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v4gD (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4gD (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakkekisagyfrvirnyyr
    fgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgysqsnlgitfndly
    eyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsd
    allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
    nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
    acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
    rqqemeaadtepfavwlekha