PDB entry 1v4e

View 1v4e on RCSB PDB site
Description: Crystal Structure of Octaprenyl Pyrophosphate Synthase from Hyperthermophilic Thermotoga maritima
Class: transferase
Keywords: trans-type prenyltransferase, thermophilic
Deposited on 2003-11-13, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: octoprenyl-diphosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v4ea_
  • Chain 'B':
    Compound: octoprenyl-diphosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v4eb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4eA (A:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    edaisslaalelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeignnklrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4eA (A:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
    alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
    rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v4eB (B:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    edaisslaalelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeignnklrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4eB (B:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
    alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
    rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf