PDB entry 1v4b

View 1v4b on RCSB PDB site
Description: The crystal structure of AzoR (Azo Reductase) from Escherichia coli: Oxidized form
Class: oxidoreductase
Keywords: Azo Reductase, OXIDOREDUCTASE
Deposited on 2003-11-12, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-azoreductase, FMN-dependent
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v4ba_
  • Heterogens: FMN, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4bA (A:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
    sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
    tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
    emaakaqsdakaaidsivsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4bA (A:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalra
    pltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfryten
    gpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygpema
    akaqsdakaaidsivsa