PDB entry 1v4a

View 1v4a on RCSB PDB site
Description: Structure of the N-terminal Domain of Escherichia coli Glutamine Synthetase adenylyltransferase
Class: transferase
Keywords: main alpha helix, DNA polymerase beta motif, TRANSFERASE
Deposited on 2003-11-12, released 2004-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate-ammonia-ligase adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30870 (0-End)
      • modified residue (0)
      • modified residue (86)
      • modified residue (97)
      • modified residue (159)
      • modified residue (201)
      • modified residue (223)
      • modified residue (257)
      • modified residue (263)
      • modified residue (277)
      • modified residue (298)
      • modified residue (301)
      • modified residue (408)
      • modified residue (424)
    Domains in SCOPe 2.06: d1v4aa1, d1v4aa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v4aA (A:)
    mkplssplqqywqtvverlpeplaeeslsaqaksvltfsdfvqdsviahpewltelesqp
    pqadewqhyaawlqealcnvsdeaglmrelrlfrrrimvriawaqtlalvteesilqqls
    ylaetlivaardwlydaccrewgtpcnaqgeaqpllilgmgklgggelnfssdidlifaw
    pehgctqggrreldnaqfftrmgqrlikvldqptqdgfvyrvdmrlrpfgesgplvlsfa
    aledyyqeqgrdweryamvkarimgdsegvyanelramlrpfvfrryidfsviqslrnmk
    gmiarevrrrgltdniklgaggireiefivqvfqlirggrepslqsrsllptlsaiaelh
    llsendaeqlrvaylflrrlenllqsindeqtqtlpsdelnrarlawamdfadwpqltga
    ltahmtnvrrvfneligdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v4aA (A:)
    mkplssplqqywqtvverlpeplaeeslsaqaksvltfsdfvqdsviahpewltelesqp
    pqadewqhyaawlqealcnvsdeaglmrelrlfrrrimvriawaqtlalvteesilqqls
    ylaetlivaardwlydaccrewgtpcnaqgeaqpllilgmgklgggelnfssdidlifaw
    pereldnaqfftrmgqrlikvldqptqdgfvyrvdmrlrpfgesgplvlsfaaledyyqe
    qgrdweryamvkarimgdsegvyanelramlrpfvfrryidfsviqslrnmkgmiarevr
    rrgltdniklgaggireiefivqvfqlirggrepslqsrsllptlsaiaelhllsendae
    qlrvaylflrrlenllqsindeqtqtlpsdelnrarlawamdfadwpqltgaltahmtnv
    rrvfnelig