PDB entry 1v48

View 1v48 on RCSB PDB site
Description: Calf spleen purine nucleoside phosphorylase (PNP) binary complex with 9-(5,5-difluoro-5-phosphonopenthyl)guanine
Class: transferase
Keywords: purine nucleoside phosphorylase, binary complex, multisubstrate analogue, inhibitor, TRANSFERASE
Deposited on 2003-11-11, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v48a_
  • Heterogens: ZN, MG, HA1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v48A (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v48A (A:)
    qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpesgr
    lvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevg
    dimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrel
    qegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvim
    dyeaaqkleqfvsllmasipv