PDB entry 1v45

View 1v45 on RCSB PDB site
Description: Crystal Structure of human PNP complexed with 3-deoxyguanosine
Class: transferase
Keywords: purine nucleoside phosphorylase, drug design, synchrotron, TRANSFERASE
Deposited on 2003-11-10, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.18
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v45e_
  • Heterogens: SO4, 3DG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v45E (E:)
    engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
    pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
    pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
    geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas