PDB entry 1v43

View 1v43 on RCSB PDB site
Description: Crystal Structure of ATPase subunit of ABC Sugar Transporter
Class: transport protein
Keywords: ATPase, active transport, sugar uptake and regulation, transport protein
Deposited on 2003-11-08, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar-binding transport ATP-binding protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v43a1, d1v43a2, d1v43a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v43A (A:)
    gnnievikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagl
    eeptegriyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeidk
    rvrwaaellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvam
    raeikklqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvat
    figapemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegvse
    lahmkrtarligkvdfvealgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmi
    hvfdkdtekaiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v43A (A:)
    vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
    griyfgdrdvtylppkdrnismvfqhmtvyeniafplkkfpkdeidkrvrwaaellqiee
    llnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeikklqqklkv
    ttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfigapemnilevs
    vgdgylegrgfrielpqmdllkdyvgktvlfgirpehmtvegvhmkrtarligkvdfvea
    lgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmihvfdkdtekaiv