PDB entry 1v3z

View 1v3z on RCSB PDB site
Description: Crystal Structure of Acylphosphatase from Pyrococcus horikoshii
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-11-07, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.169
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v3za_
  • Chain 'B':
    Compound: acylphosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v3zb_
  • Heterogens: K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v3zA (A:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3zA (A:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v3zB (B:)
    maivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealig
    wahqgpplarvtrvevkweqpkgekgfrivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3zB (B:)
    aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
    ahqgpplarvtrvevkweqpkgekgfrivg