PDB entry 1v3w

View 1v3w on RCSB PDB site
Description: Structure of Ferripyochelin binding protein from Pyrococcus horikoshii OT3
Class: transferase
Keywords: BETA-HELIX, Carbonic anhydrase, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-11-07, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferripyochelin binding protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v3wa_
  • Heterogens: ZN, CA, CL, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3wA (A:)
    maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
    nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
    vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri