PDB entry 1v3v

View 1v3v on RCSB PDB site
Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complexed with NADP and 15-oxo-PGE2
Class: oxidoreductase
Keywords: Rossmann fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2003-11-06, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EQZ5 (4-332)
      • cloning artifact (0-3)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1v3va1, d1v3va2, d1v3va3
  • Chain 'B':
    Compound: leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v3vb1, d1v3vb2
  • Heterogens: CL, NAP, 5OP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3vA (A:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v3vB (B:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3vB (B:)
    vkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkega
    vmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslalgt
    igmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdekiay
    lkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgkiaicga
    isvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegkiqyheh
    vtkgfenmpaafiemlnganlgkavvta