PDB entry 1v3t

View 1v3t on RCSB PDB site
Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
Deposited on 2003-11-05, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3tA (A:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v3tB (B:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3tB (B:)
    fmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlke
    gavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslal
    gtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdeki
    aylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgkiaic
    gaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegkiqyh
    ehvtkgfenmpaafiemlnganlgkavvta