PDB entry 1v3s

View 1v3s on RCSB PDB site
Description: Crystal structure of TT1020 from Thermus thermophilus HB8
Class: signaling protein
Keywords: structural genomics, signal transducing protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN
Deposited on 2003-11-05, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM86 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1v3sa_
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM86 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1v3sb_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM86 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1v3sc_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v3sA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3sA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetelhekvrleigvsepfvkpt
    veailkaartgevgdgkifvlpvekvyrirtgeedea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v3sB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3sB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghgmelhekvrleigvsepfvkptve
    ailkaartgevgdgkifvlpvekvyrirtgeed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v3sC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3sC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghglhekvrleigvsepfvkptveai
    lkaartgevgdgkifvlpvekvyrirtgeed