PDB entry 1v3m

View 1v3m on RCSB PDB site
Description: crystal structure of f283y mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose
Deposited on 2003-11-03, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3mA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldyrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3mB (B:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldyrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp