PDB entry 1v3l

View 1v3l on RCSB PDB site
Description: Crystal structure of F283L mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose
Class: transferase
Keywords: CGTase, Cyclodextrin, Acarbose, TRANSFERASE
Deposited on 2003-11-03, released 2004-08-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (282)
      • see remark 999 (451)
      • see remark 999 (453)
    Domains in SCOPe 2.05: d1v3la1, d1v3la2, d1v3la3, d1v3la4
  • Chain 'B':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (282)
      • see remark 999 (451)
      • see remark 999 (453)
    Domains in SCOPe 2.05: d1v3lb1, d1v3lb2, d1v3lb3, d1v3lb4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3lA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3lB (B:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp