PDB entry 1v3i

View 1v3i on RCSB PDB site
Description: The roles of Glu186 and Glu380 in the catalytic reaction of soybean beta-amylase
Class: Hydrolase
Keywords: (beta/alpha)8 barrel, Hydrolase
Deposited on 2003-11-02, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.154
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Gene: BMY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10538 (Start-494)
      • engineered (75)
      • see remark 999 (201)
      • engineered (379)
      • see remark 999 (398)
    Domains in SCOPe 2.07: d1v3ia_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v3iA (A:)
    atsdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiie
    lkgpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhd
    ifytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievg
    lgpagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkynd
    vpestgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgih
    wwykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpq
    elvqqvlsggwredirvagqnalprydataynqiilnarpqgvnnngppklsmfgvtylr
    lsddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkpt
    lpfpwlpetdmkvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v3iA (A:)
    nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
    qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
    rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
    elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
    gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
    enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
    vlsggwredirvagqnalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
    lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
    lpetdmkvdg