PDB entry 1v3f

View 1v3f on RCSB PDB site
Description: Solution structure of the DEP domain of mouse pleckstrin2
Class: protein binding
Keywords: THREE-HELIX BUNDLE, PLECKSTRIN2, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-10-31, released 2004-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2010320F03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WV52 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.07: d1v3fa1, d1v3fa2, d1v3fa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3fA (A:)
    gssgssglhrivdkmhdtstgirpspnmeqgstykktflgsslvdwlissnfaasrleav
    tlasmlmeenflrpvgvrsmgairsgdlaeqflddstalytfaesykkkvsskesgpssg