PDB entry 1v3e

View 1v3e on RCSB PDB site
Description: structure of the hemagglutinin-neuraminidase from human parainfluenza virus type iii: complex with zanamavir
Deposited on 2003-10-30, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v3ea_
  • Chain 'B':
    Domains in SCOP 1.67: d1v3eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3eA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3eB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs