PDB entry 1v3e

View 1v3e on RCSB PDB site
Description: Structure of the hemagglutinin-neuraminidase from human parainfluenza virus type III: complex with ZANAMAVIR
Class: hydrolase
Keywords: piv3 hn, native+zanamavir, hexagonal, hydrolase
Deposited on 2003-10-30, released 2004-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.08: d1v3ea_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.08: d1v3eb_
  • Heterogens: NAG, CA, SO4, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3eA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3eB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs