PDB entry 1v3c

View 1v3c on RCSB PDB site
Description: Structure of the hemagglutinin-neuraminidase from human parainfluenza virus type III: complex with NEU5AC
Class: hydrolase
Keywords: piv3 hn, native+neu5ac, hexagonal, hydrolase
Deposited on 2003-10-30, released 2004-02-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.05: d1v3ca_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.05: d1v3cb_
  • Heterogens: NAG, SLB, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3cA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3cB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs