PDB entry 1v39

View 1v39 on RCSB PDB site
Description: dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Class: methyltransferase
Keywords: methyltransferase, RNA cap, poly(a) polymerase, vaccinia, mRNA processing, transcription
Deposited on 1996-12-16, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp39
    Species: Vaccinia virus [TaxId:10254]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v39a_
  • Heterogens: SAH, M7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v39A (A:)
    gspgisgggggildsmdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllg
    elfflsklqrhgildgatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilng
    lrdvtlvtrfvdeeylrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmis
    ilnpvasslkwrcpfpdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvt
    ksdavnyekkmyylnkivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlf
    lqqsifrflnipttstekvshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v39A (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
    dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
    vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip