PDB entry 1v38

View 1v38 on RCSB PDB site
Description: Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1
Class: signaling protein
Keywords: Structural genomics, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-10-29, released 2004-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SAM-domain protein SAMSN-1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57725 (7-71)
    • clonong artifact (0-6)
    • clonong artifact (72-77)
  Domains in SCOPe 2.01: d1v38a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v38A (A:)
  gssgssgrrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadped
  rarllsaaesllsgpssg