PDB entry 1v38

View 1v38 on RCSB PDB site
Description: solution structure of the sterile alpha motif (sam) domain of mouse samsn1
Deposited on 2003-10-29, released 2004-04-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-29, with a file datestamp of 2004-04-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1v38a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v38A (A:)
  gssgssgrrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadped
  rarllsaaesllsgpssg