PDB entry 1v38

View 1v38 on RCSB PDB site
Description: Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1
Class: signaling protein
Keywords: Structural genomics, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-10-29, released 2004-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM-domain protein SAMSN-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57725 (7-71)
      • clonong artifact (0-6)
      • clonong artifact (72-77)
    Domains in SCOPe 2.07: d1v38a1, d1v38a2, d1v38a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v38A (A:)
    gssgssgrrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadped
    rarllsaaesllsgpssg