PDB entry 1v37

View 1v37 on RCSB PDB site
Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8
Class: isomerase
Keywords: phosphoglycerate mutase, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-10-29, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.206
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v37a_
  • Chain 'B':
    Compound: phosphoglycerate mutase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v37b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v37A (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v37A (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v37B (B:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v37B (B:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal