PDB entry 1v32

View 1v32 on RCSB PDB site
Description: Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g08430 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: SWI/SNF complex subunit, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-10-24, released 2004-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein RAFL09-47-K03
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAFL09-47-K03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FT92 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.07: d1v32a1, d1v32a2, d1v32a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v32A (A:)
    gssgssgkrfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkk
    kvvcdkrlvllfgtrtifrmkvydllekhykenqdsgpssg