PDB entry 1v32

View 1v32 on RCSB PDB site
Description: Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g08430 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: SWI/SNF complex subunit, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-10-24, released 2004-04-24
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein RAFL09-47-K03
  Species: Arabidopsis thaliana
  Gene: RAFL09-47-K03
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FT92 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOP 1.75: d1v32a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v32A (A:)
  gssgssgkrfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkk
  kvvcdkrlvllfgtrtifrmkvydllekhykenqdsgpssg