PDB entry 1v32

View 1v32 on RCSB PDB site
Description: solution structure of the swib/mdm2 domain of the hypothetical protein at5g08430 from arabidopsis thaliana
Deposited on 2003-10-24, released 2004-04-24
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-24, with a file datestamp of 2004-04-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1v32a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v32A (A:)
  gssgssgkrfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkk
  kvvcdkrlvllfgtrtifrmkvydllekhykenqdsgpssg