PDB entry 1v31

View 1v31 on RCSB PDB site
Description: Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g14170 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: SWI/SNF complex subunit, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-10-21, released 2004-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein RAFL11-05-P19
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RAFL11-05-P19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FMT4 (7-86)
    • cloning artifact (0-6)
    • cloning artifact (87-92)
  Domains in SCOPe 2.08: d1v31a1, d1v31a2, d1v31a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v31A (A:)
  gssgssgvpekfklstalmdvlgievetrpriiaaiwhyvkarklqnpndpsffncdaal
  qkvfgeeklkftmvsqkishhlsppppsgpssg